PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.006G173600.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family CO-like
Protein Properties Length: 385aa    MW: 42245.4 Da    PI: 6.8181
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.006G173600.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box253.9e-081963338
            zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg.........Ht 38
                        +++C+ ++   +  fC+ ++ +lC +C +++H++         H+
  Potri.006G173600.1 19 AKRCDSCKTAAAAAFCRADSAFLCLNCDTKIHHSgvnskimsrHE 63
                        579******99********************75546666666665 PP

2zf-B_box26.71.2e-0865110342
            zf-B_box   3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42 
                          ++C+ +e+ ++   C+ +   lC +C   +H+       H++vp+
  Potri.006G173600.1  65 VWMCEVCEQAPAAVTCKADAAALCVTCDADIHSAnplarrHERVPV 110
                         689*****************************66899999999986 PP

3CCT69.67.8e-24311354144
                 CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                         Rea++lRY+eKrk+RkFeK+irY+sRKa+Ae+RpR+KGrF+k++
  Potri.006G173600.1 311 REARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRT 354
                         9*****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011910.6651767IPR000315B-box-type zinc finger
SMARTSM003365.2E-51756IPR000315B-box-type zinc finger
Gene3DG3DSA:3.30.40.102.2E-41875IPR013083Zinc finger, RING/FYVE/PHD-type
PfamPF006435.7E-62063IPR000315B-box-type zinc finger
CDDcd000214.38E-62167No hitNo description
PROSITE profilePS5011910.8563110IPR000315B-box-type zinc finger
SMARTSM003369.9E-1663110IPR000315B-box-type zinc finger
PfamPF006431.0E-665110IPR000315B-box-type zinc finger
CDDcd000214.90E-966110No hitNo description
PROSITE profilePS5101716.787311353IPR010402CCT domain
PfamPF062036.0E-18311353IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009416Biological Processresponse to light stimulus
GO:0009909Biological Processregulation of flower development
GO:0005634Cellular Componentnucleus
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 385 aa     Download sequence    Send to blast
MGIEVESLKN LTGGWSVAAK RCDSCKTAAA AAFCRADSAF LCLNCDTKIH HSGVNSKIMS  60
RHERVWMCEV CEQAPAAVTC KADAAALCVT CDADIHSANP LARRHERVPV EPFYDSAESI  120
VKTSSAFNFL VPGDQNGVSA YDHNDEIEGV SWLLHGNHTT HDLNTKINIE NPVVKTGDMF  180
FCEMDPFLDF EYQNSMDGRY KQSHGGGGAG ADSVVPVQNK PAPLPVIDHK NCFDIDFCRS  240
KLTSFSSYPS QSLSHSVSSS SLDVGVVPDG NSMSDISYPF GRSMNTYTDP SMPISGSTTN  300
QAAAQLAGID REARVLRYRE KRKNRKFEKT IRYASRKAYA ETRPRIKGRF AKRTEMESDM  360
DTLYNSPSSV PFLADTHYGV VPSF*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pth.52200.0bud
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCU2247943e-77CU224794.1 Populus EST from leave.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011012685.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 5-like
SwissprotQ9FHH81e-125COL5_ARATH; Zinc finger protein CONSTANS-LIKE 5
TrEMBLU5FG520.0U5FG52_POPTR; Uncharacterized protein
STRINGPOPTR_0018s10510.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13023493
Representative plantOGRP6911767
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G57660.11e-107CONSTANS-like 5